PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_007679-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 357aa    MW: 41092.9 Da    PI: 9.6519
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_007679-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.59.8e-16453148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT..TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg..kgRtlkqcksrwqkyl 48
                     r+rW +eEd ll  +vkq+G++ W++++++m+  ++R +k+c +rw +yl
    NNU_007679-RA  4 RQRWRAEEDALLRAYVKQYGPREWNLVSERMNtpLNRDAKSCLERWKNYL 53
                     89**********************************************97 PP

2Myb_DNA-binding37.94.2e-1259103147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +g+ T+eE+ l +++ +++G++ Wk+Ia++++ gRt+k +  +w  +
    NNU_007679-RA  59 KGSLTEEEQRLVICLQAKHGNK-WKKIAAEIP-GRTAKRLGKWWEVF 103
                      6788******************.*********.*****999999766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.261153IPR017930Myb domain
SMARTSM007171.2E-13355IPR001005SANT/Myb domain
SuperFamilySSF466892.96E-21498IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.5E-20659IPR009057Homeodomain-like
CDDcd001671.80E-8653No hitNo description
PfamPF139212.0E-14768No hitNo description
PROSITE profilePS5129422.79554108IPR017930Myb domain
SMARTSM007173.6E-1058106IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-1460102IPR009057Homeodomain-like
CDDcd001677.71E-763104No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 357 aa     Download sequence    Send to blast
MKERQRWRAE EDALLRAYVK QYGPREWNLV SERMNTPLNR DAKSCLERWK NYLKPGIKKG  60
SLTEEEQRLV ICLQAKHGNK WKKIAAEIPG RTAKRLGKWW EVFKEKQQRE QKDRAKAFDP  120
IEEGKYDHIL ETFAEKLVKE RTSASFLMAT SNGGFLHSDQ SAPPPTLLPP WLSSSNATST  180
VRPPSPSVTL TLSPSTVTPA PAIPWLQPER GGDSTPLVLG NLQQHGAVPT GGDNLLISEL  240
AECCRELEEG HRAWAAHKKE ASWRLKRVEL QMESEKACRR REKMEEIESK VRALREEEKA  300
TLEKIEVEYR EQLASLRRDA EAKEQKLVEQ WAAKHMRLTK FLEQITCWPR ATEPNGR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A3e-157100797MYB PROTO-ONCOGENE PROTEIN
1mse_C3e-157100797C-Myb DNA-Binding Domain
1msf_C3e-157100797C-Myb DNA-Binding Domain
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010256929.10.0PREDICTED: transcription factor AS1-like
SwissprotO809311e-166AS1_ARATH; Transcription factor AS1
TrEMBLA0A061ER460.0A0A061ER46_THECC; Myb-like HTH transcriptional regulator family protein isoform 1
STRINGPOPTR_0006s08610.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37630.11e-147MYB family protein